Description
LL-37 5mg from Evolve Peptides is 5mg of LL-37 in a sealed glass vial. LL-37 is a human cathelicidin antimicrobial peptide. It’s for in-vitro and lab research only.
About LL-37
LL-37 is the only cathelicidin antimicrobial peptide humans make. It’s 37 amino acids long and starts with two leucines, which is where the name comes from. It’s cut from a larger precursor protein, hCAP-18, and is found in white blood cells, skin and the lining of the airways and gut.
It’s amphipathic, with one charged face and one oily face, so it can sit in and disrupt bacterial membranes.
LL-37 mechanism of action
LL-37 has a positively charged face that’s drawn to the negatively charged membranes of bacteria. Once it’s there, its oily face pushes into the membrane and makes holes.
It does more than kill microbes. It binds bacterial endotoxin, recruits immune cells and stimulates new blood vessel growth, which ties it into wound healing studies.
LL-37 5mg technical data
- Compound: LL-37
- Also known as: cathelicidin, CAP-18 fragment
- CAS number: 154947-66-7
- Molecular formula: C205H340N60O53
- Molar mass: 4,493.3 g/mol
- Structure: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
- Amount: 5mg per vial
- Form: lyophilized (freeze-dried) powder
- SKU: EVP-LL37-5
- Use: laboratory research only
What the research says about LL-37
Lab work shows it kills a wide range of bacteria and some fungi and viruses in culture, and it also acts as a signaling molecule in inflammation and wound repair. Heilborn and colleagues reported in 2003 that it’s needed for normal re-epithelialization of human skin wounds in culture.
Human data are limited to small early-phase studies, for example on venous leg ulcers.
For the original studies, try this PubMed search.
How to reconstitute LL-37 5mg
The volume of water you add sets the concentration. For a vial holding 5mg:
- 1ml of bacteriostatic water gives 5mg/ml
- 2ml of bacteriostatic water gives 2.5mg/ml
- 3ml of bacteriostatic water gives 1.67mg/ml
Go with whichever number is easiest to work with in your protocol, and label the vial with the concentration and the date you mixed it.
Bacteriostatic water is the standard choice. Add it slowly so it runs down the side of the vial, then swirl or roll until everything dissolves. Shaking can damage the peptide, so skip it.
Storing LL-37 5mg
The dry powder keeps best cold: 2 to 8°C in the fridge, or -20°C for long-term storage. After reconstitution, store it in the fridge and finish it within roughly four weeks.
LL-37 5mg lab reports and purity
We’ve put the lab paperwork for LL-37 5mg in the image gallery:
- A certificate of analysis with identity, measured quantity and HPLC purity.
- An endotoxin report from a kinetic LAL assay.
Click any image to zoom in on the numbers. Where a report names a different size, the lab tested a sibling LL-37 vial. Read the purity line, not the quantity line, when comparing.
Choosing an LL-37 size
- LL-37 2mg: 2mg for $40.00, about $20.00 per mg
- LL-37 5mg (this page): 5mg for $72.00, about $14.40 per mg
LL-37 5mg is the largest size we stock and the cheapest per milligram. It suits longer studies where you’d otherwise reorder.
Peptides often ordered with LL-37
- BPC-157 Capsules 120 Count (500mcg), 120 capsules
- ARA-290 10mg, EPO-derived peptide
- KLOW Peptide Blend 80mg, GHK-Cu, BPC-157, TB-500 and KPV in one vial
- TB-500 10mg, thymosin beta-4 peptide
- VIP 10mg, neuropeptide
Browse the full healing and recovery peptides range, or see every vial on our research peptides page.
Common questions about LL-37 5mg
How much is in the LL-37 5mg vial?
5mg of lyophilized powder. The amount is printed on the label.
Can LL-37 be used in people or animals?
No. It’s sold for laboratory research only and isn’t approved for human or veterinary use.
Is it in stock?
Yes, LL-37 5mg is in stock now.
Is LL-37 5mg lab tested?
Yes. The lab reports are in the product photos, so you can check purity before you order.
Which size should I buy?
Pick by how much you’ll use. Bigger vials cost less per milligram, smaller ones mean less sits open in the fridge. The size comparison above lists every LL-37 option.
Order LL-37 5mg today
LL-37 5mg is in stock at $72.00. Choose your quantity, add it to the cart and check out in a couple of minutes. Add a vial of bacteriostatic water if you don’t have any, so you’re ready to reconstitute when it arrives.
Need more for the same project? See the rest of our healing and recovery peptides.
For laboratory research use only. Not for human or veterinary use. Not evaluated by the FDA.
Reviews
There are no reviews yet.