Description
Our LL-37 2mg vial holds 2mg of lyophilized LL-37, a human cathelicidin antimicrobial peptide. It’s for in-vitro and lab research only.
What is LL-37?
LL-37 is the only cathelicidin antimicrobial peptide humans make. It’s 37 amino acids long and starts with two leucines, which is where the name comes from. It’s cut from a larger precursor protein, hCAP-18, and is found in white blood cells, skin and the lining of the airways and gut.
It’s amphipathic, with one charged face and one oily face, so it can sit in and disrupt bacterial membranes.
LL-37 mechanism of action
LL-37 has a positively charged face that’s drawn to the negatively charged membranes of bacteria. Once it’s there, its oily face pushes into the membrane and makes holes.
It does more than kill microbes. It binds bacterial endotoxin, recruits immune cells and stimulates new blood vessel growth, which ties it into wound healing studies.
LL-37 2mg product details
- Compound: LL-37
- Also known as: cathelicidin, CAP-18 fragment
- CAS number: 154947-66-7
- Molecular formula: C205H340N60O53
- Molar mass: 4,493.3 g/mol
- Structure: [LL-37, 37 aa]
- Amount: 2mg per vial
- Form: lyophilized (freeze-dried) powder
- SKU: EVP-LL37-2
- Use: laboratory research only
Published LL-37 studies
Lab work shows it kills a wide range of bacteria and some fungi and viruses in culture, and it also acts as a signaling molecule in inflammation and wound repair. Heilborn and colleagues reported in 2003 that it’s needed for normal re-epithelialization of human skin wounds in culture.
Human data are limited to small early-phase studies, for example on venous leg ulcers.
To read the papers yourself, start with this PubMed search for LL-37.
LL-37 purity and lab testing
The product photos for LL-37 2mg include:
- A certificate of analysis with identity, measured quantity and HPLC purity.
- An endotoxin report from a kinetic LAL assay.
Click any image to zoom in on the numbers. Where a report names a different size, the lab tested a sibling LL-37 vial. Read the purity line, not the quantity line, when comparing.
LL-37 2mg reconstitution and concentration
Here’s the math for 2mg of peptide:
- 1ml of bacteriostatic water gives 2mg/ml
- 2ml of bacteriostatic water gives 1mg/ml
Go with whichever number is easiest to work with in your protocol, and label the vial with the concentration and the date you mixed it.
Bacteriostatic water is the standard choice. Add it slowly so it runs down the side of the vial, then swirl or roll until everything dissolves. Shaking can damage the peptide, so skip it.
Storing LL-37 2mg
Store sealed vials in the fridge (2 to 8°C) or freezer (-20°C), away from light. Mixed solution goes back in the fridge and should be used within about 28 days.
Choosing an LL-37 size
- LL-37 2mg (this page): 2mg for $40.00, about $20.00 per mg
- LL-37 5mg: 5mg for $72.00, about $14.40 per mg
LL-37 2mg is the entry size, handy when you only need a little or want to try LL-37 before committing to a bigger vial.
You might also look at
- BPC-157 and TB-500 Blend 10mg/10mg, BPC-157 and TB-500 in one vial
- VIP 10mg, neuropeptide
- KPV 10mg, alpha-MSH tripeptide
- BPC-157 5mg, 15-amino-acid peptide
- Thymosin Alpha-1 10mg, thymic peptide
Browse the full healing and recovery peptides range, or see every vial on our research peptides page.
LL-37 2mg questions
How much is in the LL-37 2mg vial?
2mg of lyophilized powder. The amount is printed on the label.
What do I mix LL-37 2mg with?
Sterile bacteriostatic water. The reconstitution section above shows the concentration for each volume.
How should I store it?
Sealed vials go in the fridge, or the freezer for long-term storage. Once mixed, refrigerate and use within about 28 days.
Can LL-37 be used in people or animals?
No. It’s sold for laboratory research only and isn’t approved for human or veterinary use.
Is it in stock?
Yes, LL-37 2mg is in stock now.
Buy LL-37 2mg from Evolve Peptides
LL-37 2mg is in stock at $40.00. Choose your quantity, add it to the cart and check out in a couple of minutes. Add a vial of bacteriostatic water if you don’t have any, so you’re ready to reconstitute when it arrives.
Need more for the same project? See the rest of our healing and recovery peptides.
For laboratory research use only. Not for human or veterinary use. Not evaluated by the FDA.
Reviews
There are no reviews yet.